PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G18960.1
Common NameAG, F13C5.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 28693.2 Da    PI: 9.9141
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G18960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-312575151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  AT4G18960.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 75
                 79***********************************************95 PP

2K-box108.95.6e-36921893100
        K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  +s++ s++e +a+++qqe+akL+++i ++q+++R+l+Ge ++s+s keL++Le +Le+s+++iRskKnell+++i+++qk+e +l+++n+ Lr+k++e
  AT4G18960.1  92 NSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAE 189
                  45555699***************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-401776IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.2211777IPR002100Transcription factor, MADS-box
CDDcd002657.63E-451891No hitNo description
SuperFamilySSF554553.01E-331890IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-331939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003199.6E-272673IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-335475IPR002100Transcription factor, MADS-box
PfamPF014862.6E-27102187IPR002487Transcription factor, K-box
PROSITE profilePS5129715.276103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0004703anatomycarpel primordium
PO:0004705anatomystamen primordium
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
TAYQSELGGD SSPLRKSGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LIVFSSRGRL YEYSNNSVKG TIERYKKAIS DNSNTGSVAE INAQYYQQES AKLRQQIISI  120
QNSNRQLMGE TIGSMSPKEL RNLEGRLERS ITRIRSKKNE LLFSEIDYMQ KREVDLHNDN  180
QILRAKIAEN ERNNPSISLM PGGSNYEQLM PPPQTQSQPF DSRNYFQVAA LQPNNHHYSS  240
AGRQDQTALQ LV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_D3e-201885168Myocyte-specific enhancer factor 2A
3mu6_C3e-201885168Myocyte-specific enhancer factor 2A
3mu6_B3e-201885168Myocyte-specific enhancer factor 2A
3mu6_A3e-201885168Myocyte-specific enhancer factor 2A
3p57_J4e-201885168Myocyte-specific enhancer factor 2A
3p57_I4e-201885168Myocyte-specific enhancer factor 2A
3p57_D4e-201885168Myocyte-specific enhancer factor 2A
3p57_C4e-201885168Myocyte-specific enhancer factor 2A
3p57_B4e-201885168Myocyte-specific enhancer factor 2A
3p57_A4e-201885168Myocyte-specific enhancer factor 2A
3kov_J4e-201885168Myocyte-specific enhancer factor 2A
3kov_I4e-201885168Myocyte-specific enhancer factor 2A
3kov_B4e-201885168Myocyte-specific enhancer factor 2A
3kov_A4e-201885168Myocyte-specific enhancer factor 2A
1tqe_S4e-201885269Myocyte-specific enhancer factor 2B
1tqe_R4e-201885269Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.280880.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254595_at0.0
Expression AtlasAT4G18960-
AtGenExpressAT4G18960-
ATTED-IIAT4G18960-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected early in the floral meristem but mostly expressed in stamen and carpel primordia. {ECO:0000269|PubMed:1675158}.
Functional Description ? help Back to Top
Source Description
TAIRFloral homeotic gene encoding a MADS domain transcription factor. Specifies floral meristem and carpel and stamen identity. Binds CArG box sequences. It is the only C function gene. It interacts genetically with the other homeotic genes to specify the floral organs.
UniProtProbable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:19956801}.
Function -- GeneRIF ? help Back to Top
  1. floral phenotype of bellringer mutants is caused by derepression of AG, suggesting that BLR functions as a transcription repressor
    [PMID: 15155890]
  2. AG activates biosynthesis of gibberellin, which has been proposed to promote the shift from meristem identity to differentiation
    [PMID: 15634696]
  3. The data provides genetic evidence for the role of AP1 in these interactions by showing that the floral phenotype in the ap1 agl24 svp triple mutant is significantly enhanced.
    [PMID: 16679456]
  4. AG and miR172 have distinct functions in flower development and that they largely act independently in the negative regulation of AP2.
    [PMID: 17573799]
  5. The Arabidopsis homologs of trithorax (ATX1) and enhancer of zeste (CLF) interact to control the expression of the flower homeotic gene AGAMOUS.
    [PMID: 17881378]
  6. These results indicate that stamen identity and differentiation control by AG is achieved by the regulation of different transcriptional cascades in different floral stages.
    [PMID: 17981996]
  7. Transgenic Arabidopsis plants harboring two tissue-specific promoters, fAGIP and rAGIP in forward and reverse orientations, fAGIP::GUS or rAGIP::GUS displayed similar GUS expression specifically in carpel and stamen tissues and their primordial cells.
    [PMID: 18256838]
  8. PERIANTHIA (PAN) plays a role in regulating stem cell fate by directly controlling AG expression and suggest that this activity is spatially restricted to the centermost region of the AG expression domain.
    [PMID: 19395638]
  9. Upon enhanced central AG expression, the C-domain laterally expands necessitating tuning of the expression level of C-function genes in the wild type.
    [PMID: 19554348]
  10. GIANT KILLER (AT2G35270) acts as a molecular node downstream of AGAMOUS, regulating patterning and differentiation of reproductive organs through chromatin organization
    [PMID: 19956801]
  11. A model in which the decision whether stamens or petals develop is based on the balance between AP2 and AG activities, rather than the two being mutually exclusive.
    [PMID: 20876650]
  12. Interaction between the PINOID/ABRUPTUS gene with the AGAMOUS gene: the negative regulator of stem cells in the meristem of Arabidopsis thaliana flower
    [PMID: 21542343]
  13. AGAMOUS directly represses WUS expression by binding to the WUS locus and recruiting, directly or indirectly, PcG that methylates histone H3 Lys-27 at WUS.
    [PMID: 22028461]
  14. in the delicately balanced regulatory network, NSN1 acts to repress AG and plays an additive role with AP2 in floral organ specification.
    [PMID: 22357616]
  15. Data indicate that C function regulator AGAMOUS and the B function regulators APETALA3 and PISTILLATA control many developmental processes in conjunction, as well as independent activities.
    [PMID: 23821642]
  16. In the floral meristem, the binding of AG to WUS is reduced in top1a-2, which results in reduced H3K27me3 levels at WUS and prolonged WUS expression, and consequently loss of floral determinacy.
    [PMID: 25070639]
  17. ARF3 integrates the functions of AGAMOUS and APETALA2 in floral meristem determinacy.
    [PMID: 25187180]
  18. The ULT1 and LFY pathways act separately in regulating identity and determinacy at the floral meristem. In particular, they independently induce AG expression in the centre of the flower to terminate meristem activity.
    [PMID: 25288633]
  19. FLK and PEP physically interact with proteins involved in AG pre-mRNA processing to secure correct AG function in the floral meristem and flower
    [PMID: 25658099]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqSRX263744Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G18960.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269|PubMed:10198637, ECO:0000269|PubMed:11058164, ECO:0000269|PubMed:1675158, ECO:0000269|PubMed:17794879, ECO:0000269|PubMed:18281509, ECO:0000269|PubMed:19783648, ECO:0000269|PubMed:9783581}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G24260 (A), AT1G68640 (A), AT1G69120 (R), AT1G69180 (A), AT1G70510 (A), AT2G01500 (R), AT2G17950 (A), AT2G22540 (R), AT2G45190 (R), AT4G09960 (A), AT4G18960 (A), AT4G24540 (R), AT4G27330 (A), AT4G36920 (R), AT4G37750 (R), AT5G02030 (R), AT5G06070 (R), AT5G10510 (A), AT5G35770 (R), AT5G41410 (R), AT5G61850 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G15550(A), AT1G24260(A), AT1G68640(R), AT1G69120(R), AT1G69180(A), AT2G17950(R), AT2G44810(A), AT3G23130(A), AT3G54340(A), AT4G18960(A), AT4G27330(A), AT4G28520(A), AT4G32980(A), AT4G36920(R), AT5G14010(A)
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT5G61850LFY interacts with AG enhancer.
BINDAT4G27330Agamous (AG) interacts with a CArG-box core in the Sporocyteless (SPL) 3' UTR.
BINDAT1G24260AG interacts with AGL9.
BINDAT5G15800AG interacts with AGL2.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G18960, AT4G24540, AT4G37940, AT5G13790, AT5G15800, AT5G20240, AT5G27130, AT5G41410, AT5G60910, AT1G24260, AT1G02065, AT1G46408, AT1G48150, AT1G69120
IntActSearch P17839
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Mutations result in the replacement of the six stamens by six petals and of the carpels by a new mutant flower. {ECO:0000269|PubMed:1973265}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G18960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX535790.0X53579.1 A.thaliana agamous (AG) gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567569.30.0MADS domain transcription factor AGAMOUS, partial
SwissprotP178390.0AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBLD7M9D00.0D7M9D0_ARALL; Putative uncharacterized protein
STRINGAT4G18960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61812237
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Yu D, et al.
    Organ identity genes and modified patterns of flower development in Gerbera hybrida (Asteraceae)
    Plant J., 1999. 17(1): p. 51-62
    [PMID:10069067]
  2. Chen X,Meyerowitz EM
    HUA1 and HUA2 are two members of the floral homeotic AGAMOUS pathway.
    Mol. Cell, 1999. 3(3): p. 349-60
    [PMID:10198637]
  3. Byzova MV, et al.
    Arabidopsis STERILE APETALA, a multifunctional gene regulating inflorescence, flower, and ovule development.
    Genes Dev., 1999. 13(8): p. 1002-14
    [PMID:10215627]
  4. Alvarez J,Smyth DR
    CRABS CLAW and SPATULA, two Arabidopsis genes that control carpel development in parallel with AGAMOUS.
    Development, 1999. 126(11): p. 2377-86
    [PMID:10225997]
  5. Chen Q, et al.
    The Arabidopsis FILAMENTOUS FLOWER gene is required for flower formation.
    Development, 1999. 126(12): p. 2715-26
    [PMID:10331982]
  6. Bowman JL,Baum SF,Eshed Y,Putterill J,Alvarez J
    Molecular genetics of gynoecium development in Arabidopsis.
    Curr. Top. Dev. Biol., 1999. 45: p. 155-205
    [PMID:10332605]
  7. Western TL,Haughn GW
    BELL1 and AGAMOUS genes promote ovule identity in Arabidopsis thaliana.
    Plant J., 1999. 18(3): p. 329-36
    [PMID:10377998]
  8. Brunel D,Froger N,Pelletier G
    Development of amplified consensus genetic markers (ACGM) in Brassica napus from Arabidopsis thaliana sequences of known biological function.
    Genome, 1999. 42(3): p. 387-402
    [PMID:10382288]
  9. Davies B, et al.
    PLENA and FARINELLI: redundancy and regulatory interactions between two Antirrhinum MADS-box factors controlling flower development.
    EMBO J., 1999. 18(14): p. 4023-34
    [PMID:10406807]
  10. Busch MA,Bomblies K,Weigel D
    Activation of a floral homeotic gene in Arabidopsis.
    Science, 1999. 285(5427): p. 585-7
    [PMID:10417388]
  11. Cho S, et al.
    Analysis of the C-terminal region of Arabidopsis thaliana APETALA1 as a transcription activation domain.
    Plant Mol. Biol., 1999. 40(3): p. 419-29
    [PMID:10437826]
  12. Riechmann JL,Ito T,Meyerowitz EM
    Non-AUG initiation of AGAMOUS mRNA translation in Arabidopsis thaliana.
    Mol. Cell. Biol., 1999. 19(12): p. 8505-12
    [PMID:10567575]
  13. Bomblies K,Dagenais N,Weigel D
    Redundant enhancers mediate transcriptional repression of AGAMOUS by APETALA2.
    Dev. Biol., 1999. 216(1): p. 260-4
    [PMID:10588876]
  14. Jenik PD,Irish VF
    Regulation of cell proliferation patterns by homeotic genes during Arabidopsis floral development.
    Development, 2000. 127(6): p. 1267-76
    [PMID:10683179]
  15. Jacobsen SE,Sakai H,Finnegan EJ,Cao X,Meyerowitz EM
    Ectopic hypermethylation of flower-specific genes in Arabidopsis.
    Curr. Biol., 2000. 10(4): p. 179-86
    [PMID:10704409]
  16. Chuang CF,Meyerowitz EM
    Specific and heritable genetic interference by double-stranded RNA in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(9): p. 4985-90
    [PMID:10781109]
  17. Onouchi H,Ige
    Mutagenesis of plants overexpressing CONSTANS demonstrates novel interactions among Arabidopsis flowering-time genes.
    Plant Cell, 2000. 12(6): p. 885-900
    [PMID:10852935]
  18. Kyozuka J,Kobayashi T,Morita M,Shimamoto K
    Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
    Plant Cell Physiol., 2000. 41(6): p. 710-8
    [PMID:10945340]
  19. Krizek BA,Prost V,Macias A
    AINTEGUMENTA promotes petal identity and acts as a negative regulator of AGAMOUS.
    Plant Cell, 2000. 12(8): p. 1357-66
    [PMID:10948255]
  20. Sakai H,Krizek BA,Jacobsen SE,Meyerowitz EM
    Regulation of SUP expression identifies multiple regulators involved in arabidopsis floral meristem development.
    Plant Cell, 2000. 12(9): p. 1607-18
    [PMID:11006335]
  21. Hase Y,Tanaka A,Baba T,Watanabe H
    FRL1 is required for petal and sepal development in Arabidopsis.
    Plant J., 2000. 24(1): p. 21-32
    [PMID:11029701]
  22. Deyholos MK,Sieburth LE
    Separable whorl-specific expression and negative regulation by enhancer elements within the AGAMOUS second intron.
    Plant Cell, 2000. 12(10): p. 1799-810
    [PMID:11041877]
  23. Liu Z,Franks RG,Klink VP
    Regulation of gynoecium marginal tissue formation by LEUNIG and AINTEGUMENTA.
    Plant Cell, 2000. 12(10): p. 1879-92
    [PMID:11041883]
  24. Conner J,Liu Z
    LEUNIG, a putative transcriptional corepressor that regulates AGAMOUS expression during flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(23): p. 12902-7
    [PMID:11058164]
  25. Serrano-Cartagena J, et al.
    Genetic analysis of incurvata mutants reveals three independent genetic operations at work in Arabidopsis leaf morphogenesis.
    Genetics, 2000. 156(3): p. 1363-77
    [PMID:11063708]
  26. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  27. Honma T,Goto K
    Complexes of MADS-box proteins are sufficient to convert leaves into floral organs.
    Nature, 2001. 409(6819): p. 525-9
    [PMID:11206550]
  28. Heisler MG,Atkinson A,Bylstra YH,Walsh R,Smyth DR
    SPATULA, a gene that controls development of carpel margin tissues in Arabidopsis, encodes a bHLH protein.
    Development, 2001. 128(7): p. 1089-98
    [PMID:11245574]
  29. G
    early bolting in short days: an Arabidopsis mutation that causes early flowering and partially suppresses the floral phenotype of leafy.
    Plant Cell, 2001. 13(5): p. 1011-24
    [PMID:11340178]
  30. Prigge MJ,Wagner DR
    The arabidopsis serrate gene encodes a zinc-finger protein required for normal shoot development.
    Plant Cell, 2001. 13(6): p. 1263-79
    [PMID:11402159]
  31. Lohmann JU, et al.
    A molecular link between stem cell regulation and floral patterning in Arabidopsis.
    Cell, 2001. 105(6): p. 793-803
    [PMID:11440721]
  32. Lenhard M,Bohnert A,J
    Termination of stem cell maintenance in Arabidopsis floral meristems by interactions between WUSCHEL and AGAMOUS.
    Cell, 2001. 105(6): p. 805-14
    [PMID:11440722]
  33. Pautot V, et al.
    KNAT2: evidence for a link between knotted-like genes and carpel development.
    Plant Cell, 2001. 13(8): p. 1719-34
    [PMID:11487688]
  34. Doerner P
    Plant meristems: a m
    Curr. Biol., 2001. 11(19): p. R785-7
    [PMID:11591338]
  35. Li J,Jia D,Chen X
    HUA1, a regulator of stamen and carpel identities in Arabidopsis, codes for a nuclear RNA binding protein.
    Plant Cell, 2001. 13(10): p. 2269-81
    [PMID:11595801]
  36. Gamboa A,Paéz-Valencia J,Acevedo GF,Vázquez-Moreno L,Alvarez-Buylla RE
    Floral transcription factor AGAMOUS interacts in vitro with a leucine-rich repeat and an acid phosphatase protein complex.
    Biochem. Biophys. Res. Commun., 2001. 288(4): p. 1018-26
    [PMID:11689012]
  37. Roeder AH,Yanofsky MF
    Unraveling the mystery of double flowers.
    Dev. Cell, 2001. 1(1): p. 4-6
    [PMID:11703916]
  38. Franks RG,Wang C,Levin JZ,Liu Z
    SEUSS, a member of a novel family of plant regulatory proteins, represses floral homeotic gene expression with LEUNIG.
    Development, 2002. 129(1): p. 253-63
    [PMID:11782418]
  39. Bereterbide A,Hernould M,Farbos I,Glimelius K,Mouras A
    Restoration of stamen development and production of functional pollen in an alloplasmic CMS tobacco line by ectopic expression of the Arabidopsis thaliana SUPERMAN gene.
    Plant J., 2002. 29(5): p. 607-15
    [PMID:11874573]
  40. Chen X,Liu J,Cheng Y,Jia D
    HEN1 functions pleiotropically in Arabidopsis development and acts in C function in the flower.
    Development, 2002. 129(5): p. 1085-94
    [PMID:11874905]
  41. Western TL,Cheng Y,Liu J,Chen X
    HUA ENHANCER2, a putative DExH-box RNA helicase, maintains homeotic B and C gene expression in Arabidopsis.
    Development, 2002. 129(7): p. 1569-81
    [PMID:11923195]
  42. Parcy F,Bomblies K,Weigel D
    Interaction of LEAFY, AGAMOUS and TERMINAL FLOWER1 in maintaining floral meristem identity in Arabidopsis.
    Development, 2002. 129(10): p. 2519-27
    [PMID:11973282]
  43. Nakajima K,Benfey PN
    Signaling in and out: control of cell division and differentiation in the shoot and root.
    Plant Cell, 2002. 14 Suppl: p. S265-76
    [PMID:12045282]
  44. Hedtke B,Legen J,Weihe A,Herrmann RG,B
    Six active phage-type RNA polymerase genes in Nicotiana tabacum.
    Plant J., 2002. 30(6): p. 625-37
    [PMID:12061895]
  45. Jack T
    New members of the floral organ identity AGAMOUS pathway.
    Trends Plant Sci., 2002. 7(7): p. 286-7
    [PMID:12119159]
  46. Li QZ,Li XG,Bai SN,Lu WL,Zhang XS
    Isolation of HAG1 and its regulation by plant hormones during in vitro floral organogenesis in Hyacinthus orientalis L.
    Planta, 2002. 215(4): p. 533-40
    [PMID:12172834]
  47. Huala E,Sussex IM
    LEAFY Interacts with Floral Homeotic Genes to Regulate Arabidopsis Floral Development.
    Plant Cell, 1992. 4(8): p. 901-913
    [PMID:12297664]
  48. Schultz EA,Pickett FB,Haughn GW
    The FLO10 Gene Product Regulates the Expression Domain of Homeotic Genes AP3 and PI in Arabidopsis Flowers.
    Plant Cell, 1991. 3(11): p. 1221-1237
    [PMID:12324589]
  49. Shannon S,Meeks-Wagner DR
    A Mutation in the Arabidopsis TFL1 Gene Affects Inflorescence Meristem Development.
    Plant Cell, 1991. 3(9): p. 877-892
    [PMID:12324621]
  50. Kapoor M, et al.
    Role of petunia pMADS3 in determination of floral organ and meristem identity, as revealed by its loss of function.
    Plant J., 2002. 32(1): p. 115-27
    [PMID:12366805]
  51. Tzeng TY,Chen HY,Yang CH
    Ectopic expression of carpel-specific MADS box genes from lily and lisianthus causes similar homeotic conversion of sepal and petal in Arabidopsis.
    Plant Physiol., 2002. 130(4): p. 1827-36
    [PMID:12481066]
  52. Urban M,Daniels S,Mott E,Hammond-Kosack K
    Arabidopsis is susceptible to the cereal ear blight fungal pathogens Fusarium graminearum and Fusarium culmorum.
    Plant J., 2002. 32(6): p. 961-73
    [PMID:12492838]
  53. Cheng Y,Kato N,Wang W,Li J,Chen X
    Two RNA binding proteins, HEN4 and HUA1, act in the processing of AGAMOUS pre-mRNA in Arabidopsis thaliana.
    Dev. Cell, 2003. 4(1): p. 53-66
    [PMID:12530963]
  54. Jager M,Hassanin A,Manuel M,Le Guyader H,Deutsch J
    MADS-box genes in Ginkgo biloba and the evolution of the AGAMOUS family.
    Mol. Biol. Evol., 2003. 20(5): p. 842-54
    [PMID:12679535]
  55. Alvarez-Venegas R, et al.
    ATX-1, an Arabidopsis homolog of trithorax, activates flower homeotic genes.
    Curr. Biol., 2003. 13(8): p. 627-37
    [PMID:12699618]
  56. Hennig L,Taranto P,Walser M,Sch
    Arabidopsis MSI1 is required for epigenetic maintenance of reproductive development.
    Development, 2003. 130(12): p. 2555-65
    [PMID:12736201]
  57. Bertrand C,Bergounioux C,Domenichini S,Delarue M,Zhou DX
    Arabidopsis histone acetyltransferase AtGCN5 regulates the floral meristem activity through the WUSCHEL/AGAMOUS pathway.
    J. Biol. Chem., 2003. 278(30): p. 28246-51
    [PMID:12740375]
  58. Hong RL,Hamaguchi L,Busch MA,Weigel D
    Regulatory elements of the floral homeotic gene AGAMOUS identified by phylogenetic footprinting and shadowing.
    Plant Cell, 2003. 15(6): p. 1296-309
    [PMID:12782724]
  59. Durfee T, et al.
    The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early petal development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(14): p. 8571-6
    [PMID:12826617]
  60. Kotake T,Takada S,Nakahigashi K,Ohto M,Goto K
    Arabidopsis TERMINAL FLOWER 2 gene encodes a heterochromatin protein 1 homolog and represses both FLOWERING LOCUS T to regulate flowering time and several floral homeotic genes.
    Plant Cell Physiol., 2003. 44(6): p. 555-64
    [PMID:12826620]
  61. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  62. Pinyopich A, et al.
    Assessing the redundancy of MADS-box genes during carpel and ovule development.
    Nature, 2003. 424(6944): p. 85-8
    [PMID:12840762]
  63. Li J,Chen X
    PAUSED, a putative exportin-t, acts pleiotropically in Arabidopsis development but is dispensable for viability.
    Plant Physiol., 2003. 132(4): p. 1913-24
    [PMID:12913148]
  64. Mayama T,Ohtsubo E,Tsuchimoto S
    Isolation and expression analysis of petunia CURLY LEAF-like genes.
    Plant Cell Physiol., 2003. 44(8): p. 811-9
    [PMID:12941873]
  65. Weigel D,Alvarez J,Smyth DR,Yanofsky MF,Meyerowitz EM
    LEAFY controls floral meristem identity in Arabidopsis.
    Cell, 1992. 69(5): p. 843-59
    [PMID:1350515]
  66. Bowman JL, et al.
    SUPERMAN, a regulator of floral homeotic genes in Arabidopsis.
    Development, 1992. 114(3): p. 599-615
    [PMID:1352237]
  67. Mizukami Y,Ma H
    Ectopic expression of the floral homeotic gene AGAMOUS in transgenic Arabidopsis plants alters floral organ identity.
    Cell, 1992. 71(1): p. 119-31
    [PMID:1356630]
  68. Favaro R, et al.
    MADS-box protein complexes control carpel and ovule development in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2603-11
    [PMID:14555696]
  69. Becker A,Theissen G
    The major clades of MADS-box genes and their role in the development and evolution of flowering plants.
    Mol. Phylogenet. Evol., 2003. 29(3): p. 464-89
    [PMID:14615187]
  70. J
    Growing up green: cellular basis of plant development.
    Mech. Dev., 2003. 120(11): p. 1395-406
    [PMID:14623445]
  71. Chujo A,Zhang Z,Kishino H,Shimamoto K,Kyozuka J
    Partial conservation of LFY function between rice and Arabidopsis.
    Plant Cell Physiol., 2003. 44(12): p. 1311-9
    [PMID:14701926]
  72. Zhang P,Tan HT,Pwee KH,Kumar PP
    Conservation of class C function of floral organ development during 300 million years of evolution from gymnosperms to angiosperms.
    Plant J., 2004. 37(4): p. 566-77
    [PMID:14756763]
  73. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  74. Kramer EM,Jaramillo MA,Di Stilio VS
    Patterns of gene duplication and functional evolution during the diversification of the AGAMOUS subfamily of MADS box genes in angiosperms.
    Genetics, 2004. 166(2): p. 1011-23
    [PMID:15020484]
  75. Jack T
    Molecular and genetic mechanisms of floral control.
    Plant Cell, 2004. 16 Suppl: p. S1-17
    [PMID:15020744]
  76. Ni W, et al.
    Regulation of flower development in Arabidopsis by SCF complexes.
    Plant Physiol., 2004. 134(4): p. 1574-85
    [PMID:15047903]
  77. Breuil-Broyer S, et al.
    High-resolution boundary analysis during Arabidopsis thaliana flower development.
    Plant J., 2004. 38(1): p. 182-92
    [PMID:15053771]
  78. Lemmetyinen J, et al.
    Functional characterization of SEPALLATA3 and AGAMOUS orthologues in silver birch.
    Physiol Plant, 2004. 121(1): p. 149-162
    [PMID:15086829]
  79. Wellmer F,Riechmann JL,Alves-Ferreira M,Meyerowitz EM
    Genome-wide analysis of spatial gene expression in Arabidopsis flowers.
    Plant Cell, 2004. 16(5): p. 1314-26
    [PMID:15100403]
  80. Yu H, et al.
    Floral homeotic genes are targets of gibberellin signaling in flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(20): p. 7827-32
    [PMID:15128937]
  81. Benedito VA, et al.
    Ectopic expression of LLAG1, an AGAMOUS homologue from lily (Lilium longiflorum Thunb.) causes floral homeotic modifications in Arabidopsis.
    J. Exp. Bot., 2004. 55(401): p. 1391-9
    [PMID:15155783]
  82. Bao X,Franks RG,Levin JZ,Liu Z
    Repression of AGAMOUS by BELLRINGER in floral and inflorescence meristems.
    Plant Cell, 2004. 16(6): p. 1478-89
    [PMID:15155890]
  83. Ito T, et al.
    The homeotic protein AGAMOUS controls microsporogenesis by regulation of SPOROCYTELESS.
    Nature, 2004. 430(6997): p. 356-60
    [PMID:15254538]
  84. Sridhar VV,Surendrarao A,Gonzalez D,Conlan RS,Liu Z
    Transcriptional repression of target genes by LEUNIG and SEUSS, two interacting regulatory proteins for Arabidopsis flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(31): p. 11494-9
    [PMID:15277686]
  85. Carles CC,Lertpiriyapong K,Reville K,Fletcher JC
    The ULTRAPETALA1 gene functions early in Arabidopsis development to restrict shoot apical meristem activity and acts through WUSCHEL to regulate floral meristem determinacy.
    Genetics, 2004. 167(4): p. 1893-903
    [PMID:15342527]
  86. Pfluger J,Zambryski P
    The role of SEUSS in auxin response and floral organ patterning.
    Development, 2004. 131(19): p. 4697-707
    [PMID:15358669]
  87. Dinneny JR,Yanofsky MF
    Floral development: an ABC gene chips in downstream.
    Curr. Biol., 2004. 14(19): p. R840-1
    [PMID:15458662]
  88. Chub VV,Penin AA
    [Structure of flower in Arabidopsis thaliana: spatial pattern formation].
    Ontogenez, 2004 Jul-Aug. 35(4): p. 280-4
    [PMID:15487346]
  89. Lee JY, et al.
    Activation of CRABS CLAW in the Nectaries and Carpels of Arabidopsis.
    Plant Cell, 2005. 17(1): p. 25-36
    [PMID:15598802]
  90. Yang Y,Jack T
    Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins.
    Plant Mol. Biol., 2004. 55(1): p. 45-59
    [PMID:15604664]
  91. Gómez-Mena C,de Folter S,Costa MM,Angenent GC,Sablowski R
    Transcriptional program controlled by the floral homeotic gene AGAMOUS during early organogenesis.
    Development, 2005. 132(3): p. 429-38
    [PMID:15634696]
  92. Park SO,Zheng Z,Oppenheimer DG,Haus